PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015876153.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family MYB
Protein Properties Length: 557aa    MW: 60498.1 Da    PI: 5.1463
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015876153.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-173885148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lv++vk++G g+W+++ ++ g+ R++k+c++rw ++l
   XP_015876153.1 38 KGPWTSSEDAILVEYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 85
                     79******************************************9986 PP

2Myb_DNA-binding507e-1691134146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T++E+ l++++++++G++ W++ a++++ gRt++++k++w++
   XP_015876153.1  91 KGAFTADEERLIIELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 134
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.9363385IPR017930Myb domain
SuperFamilySSF466895.24E-3037132IPR009057Homeodomain-like
SMARTSM007171.3E-153787IPR001005SANT/Myb domain
PfamPF002491.4E-153885IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-243992IPR009057Homeodomain-like
CDDcd001674.45E-124085No hitNo description
PROSITE profilePS5129425.82986140IPR017930Myb domain
SMARTSM007171.4E-1690138IPR001005SANT/Myb domain
PfamPF002496.3E-1591134IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2593139IPR009057Homeodomain-like
CDDcd001674.85E-1293134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MSRTTNESED GVLSKYQSES PLVDESNGGH SGGAVLKKGP WTSSEDAILV EYVKKHGEGN  60
WNAVQKHSGL FRCGKSCRLR WANHLRPNLK KGAFTADEER LIIELHAKMG NKWARMAAHL  120
PGRTDNEIKN YWNTRIKRRQ RAGLPLYPPD LCLQAFQENP QSQNSGGISG GDGGHHDPLQ  180
ANSYEIPDVI FNGLKGNNDV LPYVSELSEI SANSMLIKGL GSSQYYSFMP PTIHQSKRLR  240
ESIDVFPNSS GSVRNGFSMY DQFQNDTCDK AVRSFGLSFP HDPDPSKSLL SFDVTQGSHS  300
LSNGNSSASK PTSGAVKLEL PSLQYPETDL GSWGSSPPPP LLESVDAFIQ SPPPVGAFES  360
DCPSPRNSGL LDALLHEAKT LGSGRNHSAE KSSNSSSITP GAMADNCTLN ICETEWEEYR  420
EPISPLCHST TSLFNECIST SGSSVDEPPH AETFPGSNVK LEPVDSDLVL DKERESTKQL  480
ALTRPDVLLA SDWLEQSSGC MKEQSIMTDA IATLLGDDLA TDYKHMVAGS STSSQGWGLG  540
SCAWNNMPAV CQMSDQP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-32361395107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015876153.10.0PREDICTED: transcription factor GAMYB
RefseqXP_015876154.10.0PREDICTED: transcription factor GAMYB
RefseqXP_015876155.10.0PREDICTED: transcription factor GAMYB
RefseqXP_015876156.10.0PREDICTED: transcription factor GAMYB
TrEMBLM5X3T10.0M5X3T1_PRUPE; Uncharacterized protein
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.11e-131myb domain protein 65